Protein Info for ABCV34_RS13985 in Castellaniella sp019104865 MT123

Annotation: PAS domain S-box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 667 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 182 to 189 (8 residues), see Phobius details amino acids 259 to 280 (22 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 295 to 419 (125 residues), 80.5 bits, see alignment E=5.8e-27 PF00989: PAS" amino acids 300 to 411 (112 residues), 45.2 bits, see alignment E=2.5e-15 PF08448: PAS_4" amino acids 305 to 416 (112 residues), 43.7 bits, see alignment E=8.8e-15 PF13426: PAS_9" amino acids 315 to 413 (99 residues), 45.5 bits, see alignment E=2.4e-15 PF00512: HisKA" amino acids 437 to 504 (68 residues), 34.4 bits, see alignment E=5.8e-12 PF02518: HATPase_c" amino acids 549 to 662 (114 residues), 60.7 bits, see alignment E=5.2e-20

Best Hits

Predicted SEED Role

"Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (667 amino acids)

>ABCV34_RS13985 PAS domain S-box protein (Castellaniella sp019104865 MT123)
MNTRSGAMPRQDYASPRWLVGLPLAVIVLIVAGAIAALLVSSRFERDQRGEQLISDTLWA
EQAIDFESQRLIEAMRIMGRDLDAAPDDVVLFQRRAADLLQRSVEARALCRVVSGLPSQS
CLPAYSGNDMPNAAAGRAQVWRDTLERALRLGRPAATLLGGDGTRHDLLLAVPVPGSQHV
HALLAVVSLERLLNSTLPWWFAHDNEVTLTDLDGNLLAVRDASVKGLGVYTHRIEAGVAD
QAFYLNANSTHGLPHLVPNMLTGVVIALSLLLAWSAWLLWRDLVRRSRAENALREQQALR
QAMEDSLVSGLRARDLDGRITYVNPAFCEMVGYGPEDLIGHGPDMPYLALELKDRSRQRH
AQLMAGTLSNKACESTYVRRDGTRLTVLVSEAPLLDGAGKQTGWMASIIDMTEQKRAQEF
QHQQNERMNHMARLMTMGEMASALAHELNQPLAAINSYCTAALNVMAHGGGNDTESCGLI
DKARSQAERAGRIIRRVHHFVRKTEPLPGPVALDEVIAELLHLIRLQTARAGEPIQMSIP
ATLPRVLADRVLLEQVLLNLTRNAFEAMAQLPPSERRVIISADLVQAGESATAVCVSVRD
WGAGLTQENALQAMESPFFTTKSDGMGMGLAVCRSALELMGSRLQYRGGEGGGACFYFDL
KVLEGQS