Protein Info for ABCV34_RS13970 in Castellaniella sp019104865 MT123

Annotation: TRAP transporter large permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 signal peptide" amino acids 1 to 6 (6 residues), see Phobius details amino acids 24 to 26 (3 residues), see Phobius details transmembrane" amino acids 7 to 23 (17 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 99 to 115 (17 residues), see Phobius details amino acids 125 to 147 (23 residues), see Phobius details amino acids 159 to 181 (23 residues), see Phobius details amino acids 202 to 230 (29 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details amino acids 338 to 359 (22 residues), see Phobius details amino acids 371 to 393 (23 residues), see Phobius details amino acids 401 to 419 (19 residues), see Phobius details amino acids 424 to 447 (24 residues), see Phobius details amino acids 459 to 487 (29 residues), see Phobius details PF06808: DctM" amino acids 1 to 256 (256 residues), 211.1 bits, see alignment E=1.3e-66 amino acids 216 to 482 (267 residues), 213.9 bits, see alignment E=1.9e-67

Best Hits

KEGG orthology group: K11690, C4-dicarboxylate transporter, DctM subunit (inferred from 87% identity to bpt:Bpet4768)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (492 amino acids)

>ABCV34_RS13970 TRAP transporter large permease subunit (Castellaniella sp019104865 MT123)
MLLTGMPVSIALGLTVLTYLFTMTQVPIESVAMKLFTGIENFEIMAIPFFILAGGFLTHG
GVAKRMINFATSIIGHLHGGLGLAGVLACAMFAAISGSSPATVMAIGSIILPAMLQQGFP
NKFGAGIITTSGSLGILIPPSIVMVLYSVSTNTSVGDLFIAGVVPGILLALLLGFVTWYM
ARKNNYPRFCEFEQHSPTTATGYALWGLLLCVGFTIVPPAIAIALLYGLLSLTAPAVAQG
IGLFGVLISIAWLYTAYRLGRGFTHAKLLPYESQRVWSTYWESVWGLLLIVVVMGGIYAG
VFTPTEAAAMSAVYAFFVSTCVYGDMPIKKVPKVLLDSASMSAMLLYIITNAVLFSFLMT
SESIPQQMASWILAQGLGPIAFLLVVNVLLLLAGNVMEPSSIVLIMAPILFPVAQKLGID
PIHFGILMVVNMEVGMCHPPVGLNLYVASGITKMGITELTVAVAPWLFAMIGFLLLVTYV
PAVSTWLPYALK