Protein Info for ABCV34_RS13740 in Castellaniella sp019104865 MT123

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 36 to 55 (20 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 131 to 159 (29 residues), see Phobius details amino acids 177 to 215 (39 residues), see Phobius details amino acids 225 to 253 (29 residues), see Phobius details amino acids 265 to 283 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 9 to 275 (267 residues), 123.1 bits, see alignment E=6.1e-40

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 81% identity to dar:Daro_0367)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>ABCV34_RS13740 branched-chain amino acid ABC transporter permease (Castellaniella sp019104865 MT123)
MQAEFLQFLFSGLTVGATYALVALGFNLIYNASHVINFAQGEFVMLGGMLAVFFTQIGLH
WGVAFALAVLLPAGVGVLLEKIAIEPVKDAETVTLIIITIGASLVIRGLAQVWLGKNAHS
LPPFSDHEPMFILGAMLLPQSLWVFGVTALAVVLLWYFFSRTLAGKAMLATAYNHVAAQL
VGVSTGWVLLVSFALAAALGALGGILIAPITLTSYDVGIMLGLKGFVAAVLGGLGNGLGA
VVGGLLLGILEAMGAGYVSSAYKDAIPFVLILLVLFFMPRGLFGGRSTDRV