Protein Info for ABCV34_RS13735 in Castellaniella sp019104865 MT123

Annotation: phenylacetic acid degradation operon negative regulatory protein PaaX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 PF07848: PaaX" amino acids 19 to 87 (69 residues), 84 bits, see alignment E=1e-27 TIGR02277: phenylacetic acid degradation operon negative regulatory protein PaaX" amino acids 22 to 308 (287 residues), 279.4 bits, see alignment E=1.8e-87 PF20803: PaaX_M" amino acids 107 to 166 (60 residues), 31 bits, see alignment E=3.3e-11 PF08223: PaaX_C" amino acids 195 to 286 (92 residues), 93.2 bits, see alignment E=1.6e-30

Best Hits

KEGG orthology group: K02616, phenylacetic acid degradation operon negative regulatory protein (inferred from 69% identity to dar:Daro_0386)

Predicted SEED Role

"Phenylacetic acid degradation operon negative regulatory protein PaaX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>ABCV34_RS13735 phenylacetic acid degradation operon negative regulatory protein PaaX (Castellaniella sp019104865 MT123)
MIPAIQQRLDRFRQQQRVRAGSLIMTVFGDAVLPRGGRIWLGSLIQLLEPLGLNERLVRT
SVFRLAKEQWLRADAHGRRADYVLTSSGQLRFEEASRHIYASHAPIWDRRWRLILVVGDL
DVRQRDHLRQALQWQGFGTVGGDCFVHPSTDLEAVFDALAADGLQDVLGSLLPLLAADSR
TARSASDADLVARAWNLDRLAESYATFVSDYLPILAELRRDRMARIEPREAFLLRVLLIH
DYRRLLLRDPELPEVLLPSDWPGQTARLSCRELYRRLAEPSEWHLDTHMRLADGVMPERR
TDGFERFPIDDPLSAISV