Protein Info for ABCV34_RS13690 in Castellaniella sp019104865 MT123

Annotation: homogentisate 1,2-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 PF20510: HgmA_N" amino acids 101 to 235 (135 residues), 36.1 bits, see alignment E=4.7e-13 PF04209: HgmA_C" amino acids 267 to 374 (108 residues), 23.3 bits, see alignment E=5.1e-09

Best Hits

Swiss-Prot: 55% identical to Y1345_VIBCH: Putative dioxygenase VC_1345 (VC_1345) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00451, homogentisate 1,2-dioxygenase [EC: 1.13.11.5] (inferred from 59% identity to azl:AZL_024670)

Predicted SEED Role

"Homogentisate 1,2-dioxygenase (EC 1.13.11.5)" in subsystem Homogentisate pathway of aromatic compound degradation (EC 1.13.11.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.5

Use Curated BLAST to search for 1.13.11.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (376 amino acids)

>ABCV34_RS13690 homogentisate 1,2-dioxygenase (Castellaniella sp019104865 MT123)
MKNTIAFPKAEGIYTRQAHADIPDGLYEREHGRNGFFGPASHILHTHKPTGWTHWEGPLE
LTLLDLNRLDDSAPCPWKARRFMHNAQTQVCFWKFDVPMPDLARNGDGDMILFFHKGEGE
FFCDYGHMSYREGDYINIPRGTTWRLETSVRNEVLTIEATEDLFMLPERGIAGRHAQFDL
AVLDTPKIDEAFKAQYSETETRVRAKRRQQVTTVTFPYNFLDAAGWHGDCVPVKLNWRDI
RELLSDRYHLPPTVHATFLSNTIIVCTFAPRPIESDPGALKVPFYHNNDEFDESIFYHQG
NFFSRDNIKPGMFTLHPSGFHHGPHPKAYAAAAANNKGERRYTDEVAVMIDSRYPLELDP
ATDTVKVPGYLDSWKE