Protein Info for ABCV34_RS13540 in Castellaniella sp019104865 MT123

Annotation: adenosylhomocysteinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 PF05221: AdoHcyase" amino acids 6 to 467 (462 residues), 491.1 bits, see alignment E=2.2e-151 TIGR00936: adenosylhomocysteinase" amino acids 7 to 460 (454 residues), 593.3 bits, see alignment E=1.2e-182 PF00670: AdoHcyase_NAD" amino acids 226 to 387 (162 residues), 256.5 bits, see alignment E=2.3e-80 PF02826: 2-Hacid_dh_C" amino acids 245 to 337 (93 residues), 32.3 bits, see alignment E=1.3e-11

Best Hits

Swiss-Prot: 83% identical to SAHH_BORBR: Adenosylhomocysteinase (ahcY) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: K01251, adenosylhomocysteinase [EC: 3.3.1.1] (inferred from 85% identity to put:PT7_2551)

Predicted SEED Role

"Adenosylhomocysteinase (EC 3.3.1.1)" in subsystem Methionine Biosynthesis or Methionine Degradation (EC 3.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (468 amino acids)

>ABCV34_RS13540 adenosylhomocysteinase (Castellaniella sp019104865 MT123)
MSTAHDYVIADIALADWGRREISIAETEMPGLMATREEFAASQPLKGARIAGSLHMTIQT
AVLIETLKALGAEVRWASCNIFSTQDHAAAAIAAGGTPVFAVKGESLEDYWQYTHRIFDW
QGEQANMILDDGGDATLLLHLGSRAESDPSVIAKPDNEEERVLFAAIKAQLARDPKWYST
RLARIRGVTEETTTGVHRLYQMSQRGDLKIPAINVNDSVTKSKFDNLYGCRESLVDGIKR
ATDVMVAGKIAVVCGFGDVGKGCAQALAALRAQVWVTEVDPICALQASMEGYRVVDLNDP
DVVEQADMFVTATGNYHVIDREHLYRMKDQAIVCNIGHFDSEINVASVEDLPWEEIKPQV
DHIIFPDGKRIILLAKGRLVNLGCATGHPSFVMSASFTNQTIAQIELFTRGEQYKTGQVY
VLPKHLDEKVARLHLKKLGVRLTTLSDKQADYIGVPVNGPFKPGHYRY