Protein Info for ABCV34_RS13495 in Castellaniella sp019104865 MT123

Annotation: transporter substrate-binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00497: SBP_bac_3" amino acids 41 to 269 (229 residues), 159 bits, see alignment E=1.9e-50 PF09084: NMT1" amino acids 94 to 201 (108 residues), 30.9 bits, see alignment E=4e-11 PF12974: Phosphonate-bd" amino acids 135 to 263 (129 residues), 42.4 bits, see alignment E=9.1e-15

Best Hits

Swiss-Prot: 44% identical to GLTI_SALTY: Glutamate/aspartate import solute-binding protein (gltI) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K10001, glutamate/aspartate transport system substrate-binding protein (inferred from 53% identity to tin:Tint_0351)

MetaCyc: 42% identical to glutamate/aspartate ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate Aspartate periplasmic binding protein precursor GltI (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>ABCV34_RS13495 transporter substrate-binding domain-containing protein (Castellaniella sp019104865 MT123)
MHKVLTAILASGFAIALVAAPAQSQPLDGTLAKIKQLDEISLGYRDVSVPFSYLDDRPKP
VGFAMDLCHKVADAVKTRLKLPTLRIKLVPIQLSNQIPLIQNGTIDLVCGPATNTLEREK
VVAFSDTIFVSSIRAVVRRDGPVKTLKDLNGKAIALTSASTSIALLNAYEKAHDMKTVRV
LSADHAGSFLALTTGRADAFVMDDILLASMVANSQDPQQWRLLDEALRVEPYGLILRKND
PEFKALVDHTLVGLMRSGEFQALYGKWFTQPIPPKGLNLNFPMTQPLKDAIAHPNDKGV