Protein Info for ABCV34_RS13395 in Castellaniella sp019104865 MT123

Annotation: cob(I)yrinic acid a,c-diamide adenosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 60% identical to ATR_CUPMC: Cobalamin adenosyltransferase (cobO) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K00798, cob(I)alamin adenosyltransferase [EC: 2.5.1.17] (inferred from 64% identity to put:PT7_2647)

Predicted SEED Role

"ATP:Cob(I)alamin adenosyltransferase (EC 2.5.1.17)" (EC 2.5.1.17)

MetaCyc Pathways

adenosylcobalamin salvage from cobalamin (5/5 steps found)
adenosylcobinamide-GDP salvage from cobinamide I (3/5 steps found)
adenosylcobinamide-GDP biosynthesis from cobyrinate a,c-diamide (3/6 steps found)
adenosylcobinamide-GDP salvage from cobinamide II (3/6 steps found)
cobalamin salvage (eukaryotic) (4/8 steps found)
superpathway of adenosylcobalamin salvage from cobinamide I (3/8 steps found)
superpathway of adenosylcobalamin salvage from cobinamide II (3/9 steps found)
adenosylcobalamin biosynthesis II (aerobic) (11/33 steps found)
adenosylcobalamin biosynthesis I (anaerobic) (11/36 steps found)

KEGG Metabolic Maps

Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>ABCV34_RS13395 cob(I)yrinic acid a,c-diamide adenosyltransferase (Castellaniella sp019104865 MT123)
MSIRVSIVSTRTGDDGTTGLGDKTRVPKDAPRITALGNVDELNSAIGVWRTHDLPEDVDT
LLSRIQNDLFDLGGELCIPGWTALNDAHILRLDEALAHYNAGLGPLQEFILPGGCPAAAQ
AHMARTIARRAERSVVTLAHTESVNPPVLHYLNRLSDLCFVLARHLNRESKAPDVLWMRQ
DTK