Protein Info for ABCV34_RS13180 in Castellaniella sp019104865 MT123

Annotation: 4-hydroxybenzoate octaprenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 signal peptide" amino acids 1 to 45 (45 residues), see Phobius details transmembrane" amino acids 54 to 75 (22 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 145 to 163 (19 residues), see Phobius details amino acids 172 to 195 (24 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details TIGR01474: 4-hydroxybenzoate polyprenyl transferase" amino acids 15 to 291 (277 residues), 292.8 bits, see alignment E=1.5e-91 PF01040: UbiA" amino acids 34 to 274 (241 residues), 187.3 bits, see alignment E=1.5e-59

Best Hits

Swiss-Prot: 40% identical to UBIA_AERS4: 4-hydroxybenzoate octaprenyltransferase (ubiA) from Aeromonas salmonicida (strain A449)

KEGG orthology group: K03179, 4-hydroxybenzoate octaprenyltransferase [EC: 2.5.1.-] (inferred from 72% identity to put:PT7_2773)

Predicted SEED Role

"4-hydroxybenzoate polyprenyltransferase (EC 2.5.1.39)" (EC 2.5.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.- or 2.5.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>ABCV34_RS13180 4-hydroxybenzoate octaprenyltransferase (Castellaniella sp019104865 MT123)
MRSDDWVARWLPASWGPYARLCRLDRPVGTWLTLLPALAALAQAADGWPTLWRLVIFSLG
ALLMRGVGCTFNDIFDRNFDHRVERTRFRPLTSGQLTLRAALWFALAQILVTAMLLLAIN
AYSRWLALVLVPLVVIYPLCKRFTYWPQAVLGMAFNWGMLMAWTDTRDILPWYGLAMWVG
AVLWQIGYDAIYAYIDMRDDRMLGLKSVAMRFGDQGKAWIGGMYAATAVLWTVSGWGMGM
RWPYYVVMAVIAGHFVWQVRLFDVRYPERGLRLFRSNMQVGVLLIVAALAGTTLYG