Protein Info for ABCV34_RS12915 in Castellaniella sp019104865 MT123

Annotation: nucleotide sugar dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03026: nucleotide sugar dehydrogenase
  • amino acids 1 to 385 (385 residues), 333.7 bits, E=7.1e-104
• PF03721: UDPG_MGDP_dh_N
  • amino acids 1 to 169 (169 residues), 112.3 bits, E=3.2e-36
• PF00984: UDPG_MGDP_dh
  • amino acids 192 to 281 (90 residues), 95.4 bits, E=2.8e-31
• PF03720: UDPG_MGDP_dh_C
  • amino acids 308 to 382 (75 residues), 36.3 bits, E=9.6e-13

Best Hits

Swiss-Prot: 65% identical to UDG5_ECOLX: UDP-glucose 6-dehydrogenase (kfiD) from Escherichia coli

Predicted SEED Role

"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (10/11 steps found)
• UDP-α-D-glucuronate biosynthesis (from UDP-glucose) (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-xylose biosynthesis (1/2 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.22

Use Curated BLAST to search for 1.1.1.22

Protein Sequence (395 amino acids)

>ABCV34_RS12915 nucleotide sugar dehydrogenase (Castellaniella sp019104865 MT123)
MKVTIAGTGYVGLSNGVLLAQYNEVVCLDIVPEKVAMLNRKESPIEDAEISDFLKNRPLN
FRATLDKQDAYAGADYVIIATPTDYDPENNYFDTRSIEAVACDVLAINPQAVMVIKSTVP
VGYTAKIRETLGTDNLIFSPEFLREGKALYDNLYPSRIVVGEKSKRAEAFAGLLQQGAIK
QNIPVLFTDSVEAEAIKLFANTYLALRVAYFNELDTYAARHGLDTRQIIDGVCLDPRIGA
HYNNPSFGYGGYCLPKDTKQLLANYRDVPQNLIHAVVEANTTRKDFIASEVVRLCQVSSS
HRAPIVGIYRLVMKQGSDNFRASAIQGVMKRIKAKGIEVIIYEPTLKESTYFHSRVIDDL
PAFKQNADVIIANRRSPDLDDVSEKIYTRDLFGND