Protein Info for ABCV34_RS12905 in Castellaniella sp019104865 MT123

Annotation: O-antigen ligase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 32 to 49 (18 residues), see Phobius details amino acids 69 to 87 (19 residues), see Phobius details amino acids 93 to 110 (18 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 151 to 174 (24 residues), see Phobius details amino acids 181 to 199 (19 residues), see Phobius details amino acids 205 to 222 (18 residues), see Phobius details amino acids 229 to 251 (23 residues), see Phobius details amino acids 336 to 359 (24 residues), see Phobius details amino acids 371 to 392 (22 residues), see Phobius details amino acids 398 to 413 (16 residues), see Phobius details PF04932: Wzy_C" amino acids 191 to 348 (158 residues), 61.8 bits, see alignment E=3.3e-21

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>ABCV34_RS12905 O-antigen ligase family protein (Castellaniella sp019104865 MT123)
MQASPAGFPRLSVWMTASAALFFLLTLSVPNGYSWGAGLLLAGALAGLWQRRLAQAPHAA
HWSIQDRTLCVLLTAVFLMNAVAVAWHGDEGKYLDQGVRYLLVIPVVWGLRRVRLRMDWL
WAGLALGCMGAAGVAWWQIHRMEFNRASGFITSAIPFGDMALIMAFWCLLGAALMAIRHR
LGWTALLLAGSLAGVYAFIASATRGGLVALPIMIILAAVVLIRREHVRVVLVGCGLLIVA
ITLAFTLLTAGQIAEGRFGEALSEWQAYSQQGDATNNVGSRLEAWKAALISIPDRPLLGW
SYTDYDAHLQTLIQAGRVKPFVGTLSNTHNQFLEVWLHQGTLGLMALLALLIASFWYFAQ
RLRHADVTVRVLACCGASLPAAFAAFGLTQVILGRNNGVMFFVVSLAIWWAAMRGEE