Protein Info for ABCV34_RS12615 in Castellaniella sp019104865 MT123

Annotation: ClpXP protease specificity-enhancing factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 PF04386: SspB" amino acids 5 to 145 (141 residues), 114 bits, see alignment E=3.5e-37

Best Hits

KEGG orthology group: K03600, stringent starvation protein B (inferred from 60% identity to bpe:BP0273)

Predicted SEED Role

"ClpXP protease specificity-enhancing factor / Stringent starvation protein B" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (145 amino acids)

>ABCV34_RS12615 ClpXP protease specificity-enhancing factor (Castellaniella sp019104865 MT123)
MQETSTKPYLIRALHEWCTDNGYTPYLVVTVDANTVVPVAHVHDGQITLNISPLATNRLT
LGNEYIEFESRFNGMVEHLFIPVAAISAIYARETGAGMGFEVVASQPYPGGDESQPTATP
STLAPASSGDDSPDGPKPSHLKIVK