Protein Info for ABCV34_RS12490 in Castellaniella sp019104865 MT123

Annotation: 3-hydroxyisobutyrate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 PF07991: IlvN" amino acids 3 to 78 (76 residues), 22.6 bits, see alignment E=1.4e-08 PF03807: F420_oxidored" amino acids 3 to 70 (68 residues), 32.6 bits, see alignment E=2.1e-11 PF03446: NAD_binding_2" amino acids 3 to 162 (160 residues), 167.8 bits, see alignment E=4.1e-53 TIGR01692: 3-hydroxyisobutyrate dehydrogenase" amino acids 6 to 291 (286 residues), 366.4 bits, see alignment E=5.1e-114 PF14833: NAD_binding_11" amino acids 165 to 291 (127 residues), 117.2 bits, see alignment E=1.1e-37

Best Hits

Swiss-Prot: 48% identical to MMSB_MYCBO: Probable 3-hydroxyisobutyrate dehydrogenase (mmsB) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K00020, 3-hydroxyisobutyrate dehydrogenase [EC: 1.1.1.31] (inferred from 55% identity to rru:Rru_A1833)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.31

Use Curated BLAST to search for 1.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>ABCV34_RS12490 3-hydroxyisobutyrate dehydrogenase (Castellaniella sp019104865 MT123)
MTTIAFIGLGHMGTPMSKNLLKAGYDVIGFDLAQDALASLVQSGGRAASSIADAVRGADA
VITMVPTGTHVRQVYEGDAGILAHARRDALLIDSSTIDVETSRVVHALAAGQGFAMVDAP
VSGAVPAAEAGKLVFMVGGEAANFVRAELVLRHMGSSVVHVGAAGTGQSMKACNNMMAGM
TAITLSETLALARRLGLDDQKVYDVMTHASGNCWMLQSYCPVPGPVPGAPSNRDYAPGFA
MALMLKDMRLSQKAAQAVDYETPFAARATQMYEDAVAQGHGGRDFSYMFKIVSGED