Protein Info for ABCV34_RS12375 in Castellaniella sp019104865 MT123

Annotation: MerR family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 PF13411: MerR_1" amino acids 7 to 70 (64 residues), 56.9 bits, see alignment E=2.8e-19 PF00376: MerR" amino acids 7 to 42 (36 residues), 44.8 bits, see alignment 1.3e-15 PF09278: MerR-DNA-bind" amino acids 48 to 113 (66 residues), 44.7 bits, see alignment E=2.6e-15

Best Hits

KEGG orthology group: None (inferred from 67% identity to bav:BAV3368)

Predicted SEED Role

"Predicted transcriptional regulator LiuR of leucine degradation pathway, MerR family" in subsystem HMG CoA Synthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (155 amino acids)

>ABCV34_RS12375 MerR family DNA-binding transcriptional regulator (Castellaniella sp019104865 MT123)
MRQTTWTISELAREFDVTPRTIRFYEDQGIVSPARDGRNRVYTTRDRTRLKLALRGRRLG
LQLSEIVALINLYDRSNASTTAQLRHYADTLDAHRRKLEQQRRDLDETLKEIRRQQADCE
ALLRARLDSAVHAGAPSSSPTAVAGVAPDPHLIAK