Protein Info for ABCV34_RS12275 in Castellaniella sp019104865 MT123

Annotation: TRAP transporter small permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 56 to 73 (18 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details PF04290: DctQ" amino acids 31 to 160 (130 residues), 92.9 bits, see alignment E=8.1e-31

Best Hits

Swiss-Prot: 34% identical to Y1030_HAEIN: Putative TRAP transporter small permease protein HI_1030 (HI_1030) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 47% identity to ctt:CtCNB1_3425)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>ABCV34_RS12275 TRAP transporter small permease (Castellaniella sp019104865 MT123)
MHPAEPESGRTGKPLIRKTAEAFMAITLALMVIAVFSNVVLRYAFGTGLVIYEELSRLLF
IWLVCMGTVVTAYEKRHLSFDLLVDRAGPRTRPVLDALAGVIGFVVLSMVIKGAWDQVIA
GMHSYSPVIGYPLSIAAAATLFMAAAMVVILFKQSILDRLRG