Protein Info for ABCV34_RS12240 in Castellaniella sp019104865 MT123

Annotation: glucose 1-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 6 to 193 (188 residues), 169.8 bits, E=1e-53
• PF08659: KR
  • amino acids 9 to 157 (149 residues), 39 bits, E=1.6e-13
• PF02737: 3HCDH_N
  • amino acids 10 to 86 (77 residues), 22.2 bits, E=2.4e-08
• PF13561: adh_short_C2
  • amino acids 12 to 249 (238 residues), 212.9 bits, E=1.1e-66

Best Hits

Swiss-Prot: 51% identical to TSAC_COMTE: 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2 (tsaC1) from Comamonas testosteroni

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 74% identity to hse:Hsero_2253)

MetaCyc: 51% identical to 4-sulfobenzyl alcohol dehydrogenase subunit (Comamonas testosteroni T-2)
1.1.1.M5 [EC: 1.1.1.M5]; 4-(hydroxymethyl)benzenesulfonate dehydrogenase. [EC: 1.1.1.M5, 1.1.1.257]

Predicted SEED Role

"toluenesulfonate zinc-independent alcohol dehydrogenase" in subsystem Toluene degradation

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (49/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (18/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (15/16 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• biotin biosynthesis I (13/15 steps found)
• (5Z)-dodecenoate biosynthesis I (6/6 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
• (5Z)-dodecenoate biosynthesis II (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• palmitate biosynthesis III (21/29 steps found)
• stearate biosynthesis IV (4/6 steps found)
• anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
• 4-toluenecarboxylate degradation (1/3 steps found)
• 4-toluenesulfonate degradation I (1/4 steps found)
• petroselinate biosynthesis (2/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (20/205 steps found)
• superpathway of mycolate biosynthesis (21/239 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.257 or 1.1.1.M5

Protein Sequence (252 amino acids)

>ABCV34_RS12240 glucose 1-dehydrogenase (Castellaniella sp019104865 MT123)
MRLENKVAIVTGAGSGFGRGIAATFAREGARVLVADINDAAGQETVDQIRAAQGQAKFAH
VDVASAASMHTLLASALAHYPGVDIVVNNAGATHRNRPMLEVGEAEFDRIYAINVKSIFH
SAQTFVPHFRQRGGGVFVNIASTAAIRPRPGLTWYNGTKGAVLTTSRSMAAELGPDRIRV
NCVNPVVGATGLLSEFMGVPDTPEARAKFTASIPLGRFSTPDDVANACLYLASDEASFIT
GACLEVDGGRCV