Protein Info for ABCV34_RS12225 in Castellaniella sp019104865 MT123

Annotation: TRAP transporter large permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 51 to 73 (23 residues), see Phobius details amino acids 85 to 108 (24 residues), see Phobius details amino acids 114 to 131 (18 residues), see Phobius details amino acids 142 to 166 (25 residues), see Phobius details amino acids 173 to 198 (26 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details amino acids 246 to 262 (17 residues), see Phobius details amino acids 282 to 304 (23 residues), see Phobius details amino acids 322 to 348 (27 residues), see Phobius details amino acids 360 to 381 (22 residues), see Phobius details amino acids 401 to 426 (26 residues), see Phobius details PF06808: DctM" amino acids 7 to 422 (416 residues), 313.4 bits, see alignment E=1.2e-97 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 427 (411 residues), 327.2 bits, see alignment E=6.5e-102

Best Hits

KEGG orthology group: None (inferred from 78% identity to put:PT7_3012)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>ABCV34_RS12225 TRAP transporter large permease (Castellaniella sp019104865 MT123)
MIATLLFTIFVVLMVAGVPVGVALGGAGTLAIALANPDTHWFGLMAVSQSFYAGLAKYPL
LAIPMFVLVGSIFDRSGVAAKLVRLAQSITGNGPGMLAVVAISVAMFLGGISGSGPACAA
AVGAIMIGAMNRAGYPRAYSASVVAAGAATDILIPPSIAMIVYSILVPEASVPALFAAGM
LPGILAGIGLIIPAVWLARRHNMGAQARKEPRPPFWRSLFEAIPGLAAPVIILGGMRMGY
FTPTEAAVVAVFYGLFIGMFVHRTMRWRDLFPIFREAGELSAVIMLIVTLAGIFAWSLST
LSIIDPITNAIVHSGLGEYGVLTLLILLLIVAGMFLDGISIFLIFVPLIQPVAQAFHWDL
VWLGVVLTLMVAVGQFTPPVAVNLMVSSKIARIPIESTVPWVLWLVAGMMSTLVLVVIFP
QIALWLPHYLGY