Protein Info for ABCV34_RS11895 in Castellaniella sp019104865 MT123

Annotation: tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 PF10396: TrmE_N" amino acids 9 to 125 (117 residues), 136.3 bits, see alignment E=1.2e-43 TIGR00450: tRNA modification GTPase TrmE" amino acids 13 to 470 (458 residues), 334.1 bits, see alignment E=1.6e-103 PF12631: MnmE_helical" amino acids 128 to 467 (340 residues), 189.2 bits, see alignment E=2.2e-59 PF01926: MMR_HSR1" amino acids 223 to 337 (115 residues), 89.5 bits, see alignment E=3.3e-29 TIGR00231: small GTP-binding protein domain" amino acids 223 to 346 (124 residues), 74 bits, see alignment E=1.2e-24 PF02421: FeoB_N" amino acids 223 to 345 (123 residues), 39.7 bits, see alignment E=7.3e-14

Best Hits

Swiss-Prot: 64% identical to MNME_BURP1: tRNA modification GTPase MnmE (mnmE) from Burkholderia pseudomallei (strain 1710b)

KEGG orthology group: K03650, tRNA modification GTPase (inferred from 64% identity to bpm:BURPS1710b_0307)

Predicted SEED Role

"GTPase and tRNA-U34 5-formylation enzyme TrmE" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (470 amino acids)

>ABCV34_RS11895 tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE (Castellaniella sp019104865 MT123)
MSALSTDPIIAIATAPGRGGIGVVRVSGPDLLAWAQSLCGQALRARHAHYLPFRDGQGEV
LDEGLALFFPGPHSYTGEDVLELQGHGGPAVLRRVLEDCLARGAAIGLRLAQPGEFTQRA
FLNERLDLAQAEAVADLIEASSAAAARSAMASLSGVFSAEIDALSERIVQLRMLVEATLD
FPEEEIDFLEKYQAADRLDAVTATLDGVLRTARQGLVLREGLHVVLAGQPNVGKSSLLNA
LAGEDVAIVTPIAGTTRDRVIQQIHIDGIPLHIVDTAGLRETEDTVERIGIERSWAEIAR
AQVILHLQDARHPDDPLDAEIVRRLPAGTPVLRVLNKVDLIGDHTAALGDPARVPAGVLA
SGGAGHAEVLRISAHTGAGLDALRARLLRIAGWTPGAESPWLARERHVRALEATREHLLL
AREHASHSDQVLDLFAEELRLAHEALCEITGQFTSDDLLGEIFSRFCIGK