Protein Info for ABCV34_RS11345 in Castellaniella sp019104865 MT123

Annotation: 30S ribosomal protein S5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01021: ribosomal protein uS5
  • amino acids 18 to 170 (153 residues), 212.4 bits, E=1.5e-67
• PF00333: Ribosomal_S5
  • amino acids 19 to 81 (63 residues), 85.7 bits, E=1.7e-28
• PF03719: Ribosomal_S5_C
  • amino acids 94 to 164 (71 residues), 99.8 bits, E=4.6e-33

Best Hits

Swiss-Prot: 94% identical to RS5_BORPD: 30S ribosomal protein S5 (rpsE) from Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)

KEGG orthology group: K02988, small subunit ribosomal protein S5 (inferred from 94% identity to put:PT7_2874)

MetaCyc: 66% identical to 30S ribosomal subunit protein S5 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S5p (S2e)" in subsystem Ribosomal protein S5p acylation or Ribosome SSU bacterial

Protein Sequence (173 amino acids)

>ABCV34_RS11345 30S ribosomal protein S5 (Castellaniella sp019104865 MT123)
MAKAQGKHAAEQERDDGMREKMIAVNRVSKVVKGGRTMSFAALTVVGDGDGRIGMGKGKA
REVPVAVQKAMEQARRGLLKVALKNGTLHHTVVGKHGASTVLISPAAEGTGVIAGGPMRA
IFEVMGVRNVVAKSLGSSNPYNMVRATLNGLRACSTPSEIAAKRGKTVEEILG