Protein Info for ABCV34_RS11250 in Castellaniella sp019104865 MT123

Annotation: imidazole glycerol phosphate synthase subunit HisF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00735: imidazoleglycerol phosphate synthase, cyclase subunit
  • amino acids 13 to 266 (254 residues), 361 bits, E=1.5e-112
• PF00977: His_biosynth
  • amino acids 16 to 249 (234 residues), 282.8 bits, E=3e-88
• PF01207: Dus
  • amino acids 44 to 129 (86 residues), 23.1 bits, E=5.7e-09

Best Hits

Swiss-Prot: 81% identical to HIS6_BORPE: Imidazole glycerol phosphate synthase subunit HisF (hisF) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: K02500, cyclase [EC: 4.1.3.-] (inferred from 82% identity to put:PT7_3117)

MetaCyc: 49% identical to imidazole-glycerol-phosphate synthase cycloligase subunit (Thermotoga maritima)
GLUTAMIDOTRANS-RXN [EC: 4.3.2.10]

Predicted SEED Role

"Imidazole glycerol phosphate synthase cyclase subunit (EC 4.1.3.-)" in subsystem Histidine Biosynthesis (EC 4.1.3.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• L-histidine biosynthesis (10/10 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.- or 4.3.2.10

Protein Sequence (268 amino acids)

>ABCV34_RS11250 imidazole glycerol phosphate synthase subunit HisF (Castellaniella sp019104865 MT123)
MTASISHTGESGLCCRIIPCLDVNAGRVVKGVNFVNLTDAGDPVEIARRYDEQGADEITF
LDITATSDDRGLILPIIEAVARQVFIPLTVGGGVRQVADIQRLLDAGADKVSINSAAVAR
PELVAEAARHHGSQCIVVAMDARRVSGAGEAPRWEIFTHGGRRGTGLDAVQWARRMADMG
AGELLLTSMDRDGTKSGFDLELTRAVSDAVPVPVIASGGVGTLQHLADGITLGHASAVLA
ASIFHFGQHTLAEAKDFLAAQGIQVRRT