Protein Info for ABCV34_RS11235 in Castellaniella sp019104865 MT123

Annotation: imidazoleglycerol-phosphate dehydratase HisB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00475: IGPD
  • amino acids 31 to 174 (144 residues), 215.8 bits, E=1.3e-68

Best Hits

Swiss-Prot: 80% identical to HIS7_BORPA: Imidazoleglycerol-phosphate dehydratase (hisB) from Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)

KEGG orthology group: K01693, imidazoleglycerol-phosphate dehydratase [EC: 4.2.1.19] (inferred from 82% identity to put:PT7_3120)

Predicted SEED Role

"Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19)" in subsystem Histidine Biosynthesis (EC 4.2.1.19)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Histidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.19

Protein Sequence (195 amino acids)

>ABCV34_RS11235 imidazoleglycerol-phosphate dehydratase HisB (Castellaniella sp019104865 MT123)
MRTATIERNTQETRIRVTINLDGTGARTLNTGVPFLDHMLDQIARHGLFDLDIRCDGDTH
IDDHHSVEDVGITLGQAFAAAVGTKAGLRRYGHAYVPLDEALSRVVVDLSGRPGLFYHVD
YVRARIGTFDVDLAREFFQGFVNHAQATVHIDNLRGENAHHQCETIFKAFGRALRMAAEV
DPRAGGTIPSTKGAL