Protein Info for ABCV34_RS11185 in Castellaniella sp019104865 MT123

Annotation: lipid asymmetry maintenance ABC transporter permease subunit MlaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 153 to 181 (29 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 6 to 260 (255 residues), 274.5 bits, see alignment E=5.3e-86 PF02405: MlaE" amino acids 47 to 258 (212 residues), 249.4 bits, see alignment E=1.5e-78

Best Hits

Swiss-Prot: 63% identical to MLAE_HAEIN: Intermembrane phospholipid transport system permease protein MlaE (mlaE) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 81% identity to put:PT7_3130)

Predicted SEED Role

"Uncharacterized ABC transporter, permease component YrbE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>ABCV34_RS11185 lipid asymmetry maintenance ABC transporter permease subunit MlaE (Castellaniella sp019104865 MT123)
MNRPSLHIASLGHNFVSMVVGLGAFVRLFFAILARSGILWRRPRLTAQQVHFIGNHSLLI
ISVSGLFVGFVLGLQGYYTLERYGSEEALGLLVALSLVRELGPVVTALLFAGRAGTSLTA
EIGLMKAGEQLSAMEVMAVDPVRRVLTPRFWGGVIAMPVLAAVFSMVGILGGWFVGVVLI
GIDPGAFWSQMQGGVDVVKDVLNGVIKSLVFGVVVTLIALYQGWTSRATPEGVSRATTRT
VVSGALAVLGLDFLLTALMFAH