Protein Info for ABCV34_RS11175 in Castellaniella sp019104865 MT123

Annotation: sigma-70 family RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 25 to 179 (155 residues), 105.1 bits, see alignment E=1.5e-34 PF04542: Sigma70_r2" amino acids 27 to 93 (67 residues), 66.4 bits, see alignment E=2.3e-22 PF08281: Sigma70_r4_2" amino acids 124 to 176 (53 residues), 57.4 bits, see alignment E=1.3e-19 PF04545: Sigma70_r4" amino acids 129 to 176 (48 residues), 44.2 bits, see alignment E=1.7e-15

Best Hits

Swiss-Prot: 34% identical to NCCH_ALCXX: RNA polymerase sigma factor NccH (nccH) from Alcaligenes xylosoxydans xylosoxydans

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 54% identity to tmz:Tmz1t_1920)

Predicted SEED Role

"RNA polymerase sigma factor RpoE" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>ABCV34_RS11175 sigma-70 family RNA polymerase sigma factor (Castellaniella sp019104865 MT123)
MNADADLEDMRYAVRASAGDANAYAWLVTRHQGAVHRYLVRLIGVPEIARELTQDTFLRA
YQAIRTWQPEARFLTWLFRIAHNLALDHLRRAKHVRLEPLDEGLDVPDPAPGPEKQLETR
QRARELERALATLAPAHREVLLLREIEEMSYEDIAHTLDLNLGTVRSRIARARTALLAAL
RT