Protein Info for ABCV34_RS11105 in Castellaniella sp019104865 MT123

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 104 to 126 (23 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details amino acids 306 to 328 (23 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 11 to 105 (95 residues), 57.2 bits, see alignment E=1.9e-19 PF00528: BPD_transp_1" amino acids 117 to 337 (221 residues), 158.9 bits, see alignment E=1.2e-50

Best Hits

Swiss-Prot: 72% identical to DDPB_ECOLI: Probable D,D-dipeptide transport system permease protein DdpB (ddpB) from Escherichia coli (strain K12)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 77% identity to pfl:PFL_4025)

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>ABCV34_RS11105 ABC transporter permease (Castellaniella sp019104865 MT123)
MNGSWLPVAGRRLLSLVWVVVGVSLITFVISHLVPGDPARLVAGDRATPEIVAHIRTQLG
LDLPLPQQYLRYMGQLLQGDLGTSIRTHRPVLQDIAAFFPATLELALVALILATLLGIPL
GVVSAVQRNRFADHVARILAVAGISTPAFWLGLGLIVVFYGDLGWLPGGGRLDQGMMPPP
TVTGLYLIDAALAGDWPVWRNALWHMILPALTLGFVHLGVVARQIRSSMLEQLGEDYVRT
ARAYGLSPWAVVLRHALPNALIPSVTVLGLALGDLLYGAVLTETVFGWPGMGAYVVDSIQ
ALDFPAVMGFAVVVSFAYVVLNLLVDLLYRRLDPRIRGVG