Protein Info for ABCV34_RS11100 in Castellaniella sp019104865 MT123

Annotation: D,D-dipeptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 78 to 102 (25 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details PF12911: OppC_N" amino acids 3 to 51 (49 residues), 34.7 bits, see alignment 1.2e-12 PF00528: BPD_transp_1" amino acids 92 to 275 (184 residues), 102.6 bits, see alignment E=2.3e-33

Best Hits

Swiss-Prot: 63% identical to DDPC_ECOLI: Probable D,D-dipeptide transport system permease protein DdpC (ddpC) from Escherichia coli (strain K12)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 68% identity to pba:PSEBR_a2907)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>ABCV34_RS11100 D,D-dipeptide ABC transporter permease (Castellaniella sp019104865 MT123)
MSYFLYQLRRSPLMLLGLIVLLAVGLAVVLAGWIAPHDPEKLDLVHRLAAPSAQHWFGTD
EVGRDIFSRVLYGGRQSIGVGLFVAGCASVVGAIIGCFSGILGGRIDGLIMRVMDVVLSV
PSLVLIMALAAALGPSLFNAMLAITLVRIPFYVRLARGQTLGIREMAYVQAAWTFGATRR
HVVRWHVVRNAASPIVVQATLDVGGAILMAAALGFIGLGAQQPTAEWGAMVATGRNFLLD
QWWYTVTPGCAILVTALACNLVGDGVRDLLDPKSRVK