Protein Info for ABCV34_RS10785 in Castellaniella sp019104865 MT123

Annotation: 50S ribosomal protein L21

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00829: Ribosomal_L21p
  • amino acids 1 to 100 (100 residues), 129.5 bits, E=2.5e-42
• TIGR00061: ribosomal protein bL21
  • amino acids 2 to 101 (100 residues), 123.1 bits, E=2.6e-40

Best Hits

Swiss-Prot: 85% identical to RL21_BORPD: 50S ribosomal protein L21 (rplU) from Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)

KEGG orthology group: K02888, large subunit ribosomal protein L21 (inferred from 85% identity to bpt:Bpet4677)

MetaCyc: 50% identical to 50S ribosomal subunit protein L21 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L21p" in subsystem Ribosome LSU bacterial

Protein Sequence (103 amino acids)

>ABCV34_RS10785 50S ribosomal protein L21 (Castellaniella sp019104865 MT123)
MYAVIKTGGKQYRVCAGQKLKIEQIPADIGQEISLDQVLSVGEGETLKIGTPFVTGAAVK
ATVLAQGRHDKVKIFKMRRRKHYQKHQGHRQNYTEIRIDAVAA