Protein Info for ABCV34_RS10780 in Castellaniella sp019104865 MT123

Annotation: sodium:solute symporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 46 to 69 (24 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 125 to 153 (29 residues), see Phobius details amino acids 159 to 181 (23 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 274 to 300 (27 residues), see Phobius details amino acids 323 to 348 (26 residues), see Phobius details amino acids 371 to 387 (17 residues), see Phobius details amino acids 393 to 417 (25 residues), see Phobius details amino acids 424 to 444 (21 residues), see Phobius details amino acids 451 to 470 (20 residues), see Phobius details PF00474: SSF" amino acids 39 to 433 (395 residues), 147.2 bits, see alignment E=3.3e-47

Best Hits

KEGG orthology group: None (inferred from 68% identity to csa:Csal_2927)

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (490 amino acids)

>ABCV34_RS10780 sodium:solute symporter family protein (Castellaniella sp019104865 MT123)
MSTTAIWIGALIYLIVSVGVAWMSRDESTNGRSVSMSGYFLGARRFGGFVSALSYSATTY
SAFMMVGLAGLTYTAGVGAFGFEIVYFVGVSLVAIFGPRFWRVGKAYDFITPSEMLGHRY
QSKSVAVSTALTNCLFLIPYAAVQLAGVGYLLVGMSDGAISFTTGTVFATIVALVFSYIA
GMRSVMWTDALQAAFMLVSAFAVALLVVHHLGGLSSMFGQLAEVKGQVLTVPGPGFFSFA
TFLGLTLPWFFFSLSNPQVSQRLFMPKSLPAMRLMLLGFLCFGLVYTLVAVTWGFGALLA
LPGLPKADLATPRLLASGIVPPLLAEVVMIGILAAAISTIDSIMLTLSSMLSRDVYAHAS
GHQDDRRQVRFGKWVLAIIAVLALAFAELQLNLIAVLSVAASTGLAVTVPAIIGAFYWRR
GTAAGALASIVGGSAVVLLMFATGIQPLGLSAGVWVLPVSVVLFVAVSLCTRAPTKTADE
FIAHSHWRKA