Protein Info for ABCV34_RS10450 in Castellaniella sp019104865 MT123

Annotation: tRNA 2-thiocytidine(32) synthetase TtcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 PF01171: ATP_bind_3" amino acids 25 to 187 (163 residues), 56 bits, see alignment E=2.2e-19

Best Hits

Swiss-Prot: 74% identical to TTCA_BORPD: tRNA-cytidine(32) 2-sulfurtransferase (ttcA) from Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)

KEGG orthology group: K14058, tRNA 2-thiocytidine biosynthesis protein TtcA (inferred from 76% identity to put:PT7_2446)

MetaCyc: 62% identical to tRNA cytosine32 2-sulfurtransferase TtcA (Escherichia coli K-12 substr. MG1655)
2.8.1.M2 [EC: 2.8.1.M2]

Predicted SEED Role

"tRNA(Cytosine32)-2-thiocytidine synthetase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>ABCV34_RS10450 tRNA 2-thiocytidine(32) synthetase TtcA (Castellaniella sp019104865 MT123)
MVKRLLRETGKAIGDYAMIENGDRVMVCLSGGKDSYGLLDILLTLRERAPIDFEIIAVNL
DQKQPGFPEHVLPDYLSARGIPFHIENQDTYSVVKRLIPEGKTTCSLCSRLRRGILYRVA
RELGATKIALGHHRNDILATFFLNLFYGGRMKAMPPKLVSDNGEHVIIRPLAYVHEKDLI
AYAKLREFPIIPCNLCGSQENLKRKEISRMLEEWDRHFTNRTWNIFRALSHVVPSHLMDP
QLMDFQHLRSTGKTDADGDRAFDEEDFPAPAFSEDGDDADDAITQADHRGIPGPEEQVIM
RPRIRPAP