Protein Info for ABCV34_RS10330 in Castellaniella sp019104865 MT123

Annotation: F0F1 ATP synthase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 TIGR01039: ATP synthase F1, beta subunit" amino acids 3 to 472 (470 residues), 815.2 bits, see alignment E=8.4e-250 PF02874: ATP-synt_ab_N" amino acids 6 to 78 (73 residues), 58.2 bits, see alignment E=9.7e-20 PF00006: ATP-synt_ab" amino acids 135 to 354 (220 residues), 230.4 bits, see alignment E=2e-72

Best Hits

Swiss-Prot: 90% identical to ATPB_BORA1: ATP synthase subunit beta (atpD) from Bordetella avium (strain 197N)

KEGG orthology group: K02112, F-type H+-transporting ATPase subunit beta [EC: 3.6.3.14] (inferred from 94% identity to put:PT7_2433)

MetaCyc: 80% identical to ATP synthase F1 complex subunit beta (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP synthase beta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (473 amino acids)

>ABCV34_RS10330 F0F1 ATP synthase subunit beta (Castellaniella sp019104865 MT123)
MSNGTIVQCIGAVVDIQFPRDSIPNIYDALTLTDESSAYAEKGLTFEVQQQLGDGVVRTI
AMGSSDGLRRGMAVANTGAPISVPVGQGTLGRIMDVLGRPIDERGDIQSNEKRAIHQHAP
KFDELSPSVELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMLELINNIAKAHSGLS
VFAGVGERTREGNDFYHEMSDAGVIKLDNLAESKVAMVFGQMNEPPGNRLRVALSGLTMA
ESFRDEGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGKLQERITSTKT
GSITSIQAVYVPADDLTDPSPATTFLHLDSTVVLSRDIAALGIYPAVDPLDSTSRQLDPQ
IVGEEHYGVARAVQQTLQRYKELRDIIAILGMDELSPEDKQAVARARKIQRFLSQPFHVA
EVFTGSPGKYVPLAETLRGFKMIVEGECDALPEQAFYMVGSIDEAFEKAKTLQ