Protein Info for ABCV34_RS09995 in Castellaniella sp019104865 MT123

Annotation: ATP-dependent zinc metalloprotease FtsH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 671 transmembrane" amino acids 41 to 59 (19 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details PF06480: FtsH_ext" amino acids 42 to 154 (113 residues), 35.3 bits, see alignment E=2.8e-12 TIGR01241: ATP-dependent metallopeptidase HflB" amino acids 168 to 652 (485 residues), 679.5 bits, see alignment E=1.5e-208 PF00004: AAA" amino acids 254 to 386 (133 residues), 148.4 bits, see alignment E=4.1e-47 PF17862: AAA_lid_3" amino acids 411 to 452 (42 residues), 54.3 bits, see alignment 1.9e-18 PF01434: Peptidase_M41" amino acids 467 to 652 (186 residues), 224.5 bits, see alignment E=2.7e-70

Best Hits

KEGG orthology group: K03798, cell division protease FtsH [EC: 3.4.24.-] (inferred from 52% identity to rfr:Rfer_2011)

Predicted SEED Role

"Cell division protein FtsH (EC 3.4.24.-)" in subsystem Bacterial Cell Division (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (671 amino acids)

>ABCV34_RS09995 ATP-dependent zinc metalloprotease FtsH (Castellaniella sp019104865 MT123)
MKWSKASRPPNRTDAPRGAPAGRPSAPGQGGQPGGLHPGRIWWLFLVVLAVNYALMRFFT
PGEETPITIPYTVFKAQVTQGNVTAIYSQGDRIEGRFVHPFTWPSPGASGGGSPAVGSES
SPRTSHTFESILPTFIDPGFERFLNEHKVEIQAVPIQTSNLMGTLLYGFGPALIIIVFYV
WMYRRAAQGGGGMGAAFGMGKSKARRYDQDTEHRVTFDDVAGIDEAENELVEIVHFLKDP
EKYSRLGGSAPKGVLLIGAPGTGKTLLAKAVAGEAGVPFFSMSAAEFVEMIVGVGAARVR
DLFRQAREHAPSIIFIDEIDSIGRARGQVAIGGTSEQEQTLNQILTEMDGFSGREGVIVL
AATNQPDILDKALLRAGRFDRRVVVNLPDKIGRQAILKVHTRKVPLAEGTSLSQVAEATP
GLSGADLKNLVNEAALLAARREQDFVTQKDFDDSLEKIVLGPERPLILSHADRERIAYHE
SGHAILGLLVAGADPVHRVSIVPRGQALGVTYQRPSSDRYNYPEAYLHARIVGMLGGRAA
EEVVYGTRTTGAENDIEQATGLARNMVTRWGMSDKLGMVQLAERQNPYLGNTYGGGPTLS
ERTASLVDAEVQAIISECHSKALTLLREHRRALDALVQALLERETLNEKEICEATGLPPA
APLEELPHTPA