Protein Info for ABCV34_RS09925 in Castellaniella sp019104865 MT123

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 541 transmembrane" amino acids 168 to 186 (19 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details PF00989: PAS" amino acids 22 to 107 (86 residues), 44.2 bits, see alignment E=4.5e-15 TIGR00229: PAS domain S-box protein" amino acids 23 to 113 (91 residues), 45.4 bits, see alignment E=4.3e-16 PF13426: PAS_9" amino acids 24 to 106 (83 residues), 43.2 bits, see alignment E=1e-14 PF08447: PAS_3" amino acids 31 to 105 (75 residues), 49.6 bits, see alignment E=9.9e-17 PF00015: MCPsignal" amino acids 326 to 480 (155 residues), 142.5 bits, see alignment E=3.1e-45

Best Hits

KEGG orthology group: K03776, aerotaxis receptor (inferred from 47% identity to rsl:RPSI07_mp1250)

Predicted SEED Role

"Aerotaxis sensor receptor protein" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (541 amino acids)

>ABCV34_RS09925 methyl-accepting chemotaxis protein (Castellaniella sp019104865 MT123)
MRKNLPVTPHEYDFPDHETLLSATDVKGRITYANAAFVRISGFEYGELLGKAHNIVRHPD
VPPEAFQDLWDTLKLGRSWTAVLKNRRKNGDSYWVRANVTPVYHQSTLSGYVSVRTKPSR
AEIEASERVFEDFRHQRQKVRFHHGLLFDTGWRRWRNVFRTVSLRQRLALTLSGLWGLWS
LTIWQAGLTDQALLAASVAGLGLSGIAGLALERRLIHPLHAIQRQAIQAASGQAVDDWRL
TRLDEVASIQKAVKQCSLNLRSFTDDVQNQLVGLRHASTEIAQGSQHLSIQTESAANRLN
ETAADMERLTGLVEDNTGHAQHAVGLAQASSESATRAAQVVREAAAQIEQMDAASKRIGD
IVGVIDSIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRALAQRSASAAKEIGGLIQD
VVHIAQGGVSRTREAAEAMRDVLTQNTQVSELIRRIHEAGSAQANDLQRIQQTFAQLGDL
TQGNAAMAEQSSMAVLTMNAQTHNLSQAAEVFREKMTHTVEPARSRLTPPPTQLTLQASQ
G