Protein Info for ABCV34_RS09860 in Castellaniella sp019104865 MT123

Annotation: tol-pal system protein YbgF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF13525: YfiO" amino acids 109 to 229 (121 residues), 36.4 bits, see alignment E=1.3e-12 TIGR02795: tol-pal system protein YbgF" amino acids 110 to 227 (118 residues), 111 bits, see alignment E=2.7e-36 PF13174: TPR_6" amino acids 112 to 143 (32 residues), 15.9 bits, see alignment 4.2e-06 amino acids 148 to 179 (32 residues), 27.4 bits, see alignment 9.1e-10 amino acids 185 to 217 (33 residues), 19.2 bits, see alignment 3.7e-07 PF13432: TPR_16" amino acids 114 to 181 (68 residues), 35.7 bits, see alignment E=2.6e-12

Best Hits

KEGG orthology group: None (inferred from 54% identity to bav:BAV2917)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (230 amino acids)

>ABCV34_RS09860 tol-pal system protein YbgF (Castellaniella sp019104865 MT123)
MHALPHRLNALSVSALFALMLAAPAAHAFADDDARRAILELRTQIQQMQSQNQQARLQLA
DQMDLMSQEIATLRGRVEELGQLSRQSAAGQENAPQQQAQQGQQTGDPQQQAAYQAAADQ
YRNGRYKDAASGFATFVQSYPDSQLATDALFYLGSSQYASKDFKNSIQTMQSLVKKHPDD
ARAPDALLVVAADQIELNDMKGAKASLQRIIKDYPRSSAAETAKSRLKLL