Protein Info for ABCV34_RS09855 in Castellaniella sp019104865 MT123

Annotation: peptidoglycan-associated lipoprotein Pal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02802: peptidoglycan-associated lipoprotein
  • amino acids 59 to 161 (103 residues), 131.5 bits, E=5.9e-43
• PF00691: OmpA
  • amino acids 61 to 156 (96 residues), 78.4 bits, E=2.2e-26

Best Hits

Swiss-Prot: 42% identical to PAL_PASMU: Peptidoglycan-associated lipoprotein (pal) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K03640, peptidoglycan-associated lipoprotein (inferred from 79% identity to put:PT7_3672)

Predicted SEED Role

"18K peptidoglycan-associated outer membrane lipoprotein; Peptidoglycan-associated lipoprotein precursor; Outer membrane protein P6; OmpA/MotB precursor"

Protein Sequence (164 amino acids)

>ABCV34_RS09855 peptidoglycan-associated lipoprotein Pal (Castellaniella sp019104865 MT123)
MSSRITRTLTIAAFAASLAACSSVPLDQNGANGAGSNSASAGQIMDPFNPQSPLAQQRSV
YFDFNSYTIPEQYRSVVEMHSNYLTGHPNQKVRIEGNTDARGSSEYNLALGQRRSDAVAR
AMKLLGVNANQMEAISYGKERPKAQGNTEADYAENRRADIDYQR