Protein Info for ABCV34_RS09850 in Castellaniella sp019104865 MT123

Annotation: Tol-Pal system beta propeller repeat protein TolB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 29 to 431 (403 residues), 506.2 bits, see alignment E=3.6e-156 PF04052: TolB_N" amino acids 38 to 135 (98 residues), 86.6 bits, see alignment E=2.5e-28 PF07676: PD40" amino acids 202 to 232 (31 residues), 36 bits, see alignment (E = 1e-12) amino acids 241 to 275 (35 residues), 26.6 bits, see alignment 9e-10 amino acids 284 to 319 (36 residues), 36.2 bits, see alignment 8.8e-13 amino acids 329 to 362 (34 residues), 31.9 bits, see alignment 1.9e-11

Best Hits

Swiss-Prot: 68% identical to TOLB_BORPE: Tol-Pal system protein TolB (tolB) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: K03641, TolB protein (inferred from 76% identity to put:PT7_3673)

MetaCyc: 42% identical to Tol-Pal system periplasmic protein TolB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>ABCV34_RS09850 Tol-Pal system beta propeller repeat protein TolB (Castellaniella sp019104865 MT123)
MTVFTASGFIGRLWRRTAAAGLGIALAAATATTAQAQLRVDISGVGATQYPIAIADFAGT
SGGTSTHEVIRADLTRSGQFRLINTAGAQLNVQSAIDYGTWQARGADYLAYGSVAQNGSQ
YTVSYRLVDNVRKSELDQATFSGTESEMRRIAHKIADRIYEKITGVRGVFSTRIAYVLQT
SNGYELQIADADGQNPQVMLRSKQSIISPAWSPDGSKLAYVSFESGKSVIYVQTLATAQR
QPISNYKGNNSAPAWSPDGKHMAIVLSMDGISQIYTINADGSDLRRVMRSPLIDTEPFYT
RDGQSLVFTSDRGGSPQVYKVPASGGDAQRVTFSGSYNISPRVSPDGQQLVYVTRRNGAF
RIASLSLSSGAEQLLTDGPDDQSPSYAPNGMQVLYSSIQNGRSVLAVTSIDGRVRQTLSV
LNGKVREPAWGPFTN