Protein Info for ABCV34_RS09830 in Castellaniella sp019104865 MT123

Annotation: tol-pal system-associated acyl-CoA thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 TIGR02799: tol-pal system-associated acyl-CoA thioesterase" amino acids 12 to 134 (123 residues), 162.2 bits, see alignment E=6.7e-52 TIGR00051: acyl-CoA thioester hydrolase, YbgC/YbaW family" amino acids 14 to 128 (115 residues), 108.9 bits, see alignment E=1.8e-35 PF13279: 4HBT_2" amino acids 19 to 133 (115 residues), 60.8 bits, see alignment E=1.8e-20 PF03061: 4HBT" amino acids 24 to 108 (85 residues), 56.2 bits, see alignment E=3.6e-19

Best Hits

Swiss-Prot: 45% identical to YBGC_HAEIN: Acyl-CoA thioesterase YbgC (ybgC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 56% identity to put:PT7_3677)

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase family active site" in subsystem Ton and Tol transport systems

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (141 amino acids)

>ABCV34_RS09830 tol-pal system-associated acyl-CoA thioesterase (Castellaniella sp019104865 MT123)
MNSASSDATGELSVRVYYEDTDTGGVVYYANYLKFFERGRTEWLRSLGMDQRELVTREQM
MFVVRHADIAYRQPARLDDRIDIRTTVAELRASTLVFHQQALRDGELLVSATVQVCTVHA
VTFKPIRLSPAIRDLLNKALH