Protein Info for ABCV34_RS09605 in Castellaniella sp019104865 MT123

Annotation: preprotein translocase subunit SecA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 915 PF07517: SecA_DEAD" amino acids 5 to 402 (398 residues), 433.2 bits, see alignment E=1.2e-133 TIGR00963: preprotein translocase, SecA subunit" amino acids 27 to 825 (799 residues), 1116.5 bits, see alignment E=0 PF01043: SecA_PP_bind" amino acids 231 to 358 (128 residues), 125.2 bits, see alignment E=4.5e-40 PF21090: P-loop_SecA" amino acids 417 to 622 (206 residues), 313.1 bits, see alignment E=2.1e-97 PF07516: SecA_SW" amino acids 624 to 836 (213 residues), 226.3 bits, see alignment E=1e-70 PF02810: SEC-C" amino acids 895 to 913 (19 residues), 41.3 bits, see alignment (E = 2.8e-14)

Best Hits

Swiss-Prot: 78% identical to SECA_BORBR: Protein translocase subunit SecA (secA) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: K03070, preprotein translocase subunit SecA (inferred from 79% identity to axy:AXYL_00798)

Predicted SEED Role

"Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (915 amino acids)

>ABCV34_RS09605 preprotein translocase subunit SecA (Castellaniella sp019104865 MT123)
MVSLLKKIIGSRNDRLLKQYRKQVAQINALEPSLQALSDDELKAKTDEFRQRIAGGKSLN
SLLPEAFAVVREASKRVFGMRHFDVQLLGAIALHNGKIAEMRTGEGKTLMATLAVYLNAL
PARGVHVVTVNDYLARRDAEWMGRLYGFLGLSVGVVVPQQENEEKRAAYQADITYGTNNE
YGFDYLRDNMEFRPEDRRQRSLVYAIVDEVDSILIDEARTPLIISGQAEDNTELYVRMNA
VPPLLTRMTEEPKPHEPEPDGDFWVDEKAQQVHLSEAGQIKAEQIMSRLGILPEGESLYD
PRHIALIHHLLVALRANNLFHRDQQYVVQNGEVVIVDEFTGRLMAGRRWSDGLHQAVEAK
EGVRIQNENQTLASITFQNYFRMYDKLSGMTGTADTEAYEFQEIYGLETVIIPTNRPMAR
KDQNDQVFKTDAEKYQAILADIVDCHKRGQPVLVGTTSIENSERLSDALKKEGLPHDVLN
AKQHAREAEIVAEAGKPGHITIATNMAGRGTDIVLGGSVEKQIDLVRANADLTHEDKESR
IAAIRAEWAPANEAVKQAGGLRIVGTERHESRRIDNQLRGRAGRQGDPGSSRFYLSLDDS
LMRIFAGDRVRAIMERLRLPEGEPIEARMVSRSIESAQRKVEGRNFDIRKQLLEYDDVAN
DQRKVLYGQRNEVLEATSVAETIGNLRDAEITTVFRRYLPEETMEEQWDVPGLQTTLESD
WAMPMPLAEMLEKEPNLTDDDLLERVLAEAKRLYDDKVALVGSEGWGPFERSVLLQALDT
NWRAHLASLDHLRQGIHLRGYAQVDPKQAYKREAFTLFSDMLDRIRNETIRVLMTVRIQS
AEQVEVEEPASPALENVRYHHADYDAALRGDDPGLDQAPDQAAGMPAGAVPRVGRNDPCP
CGSGKKYKHCHGRLA