Protein Info for ABCV34_RS09595 in Castellaniella sp019104865 MT123

Annotation: acyl-CoA thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 PF03061: 4HBT" amino acids 26 to 101 (76 residues), 68.8 bits, see alignment E=2.1e-23

Best Hits

Swiss-Prot: 48% identical to YCIA_SALTY: Acyl-CoA thioester hydrolase YciA (yciA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K10806, acyl-CoA thioesterase YciA [EC: 3.1.2.-] (inferred from 83% identity to bpt:Bpet0712)

MetaCyc: 47% identical to acyl-CoA thioesterase YciA (Escherichia coli K-12 substr. MG1655)
Acyl-CoA hydrolase. [EC: 3.1.2.20]

Predicted SEED Role

"Acyl-CoA hydrolase (EC 3.1.2.20)" (EC 3.1.2.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.- or 3.1.2.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (130 amino acids)

>ABCV34_RS09595 acyl-CoA thioesterase (Castellaniella sp019104865 MT123)
MSDTLPSHHRPAVLRVMPMPADANIHGDVFGGWIMSQVDIAGSIPAARRAGGRVATVAVN
AFTFKQPVFVGDLLSFYAEITRSGRTSITVDVEVYAERQRLETEVVKVTEATLTYVATDE
NRHSRPLPPI