Protein Info for ABCV34_RS09550 in Castellaniella sp019104865 MT123

Annotation: tricarballylate utilization 4Fe-4S protein TcuB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 transmembrane" amino acids 116 to 138 (23 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details amino acids 271 to 293 (23 residues), see Phobius details amino acids 313 to 329 (17 residues), see Phobius details amino acids 335 to 356 (22 residues), see Phobius details TIGR02484: CitB domain protein" amino acids 21 to 380 (360 residues), 409.9 bits, see alignment E=5.3e-127

Best Hits

Swiss-Prot: 63% identical to CITB_SALTY: Citrate utilization protein B (citB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K13795, citrate/tricarballylate utilization protein (inferred from 69% identity to bxe:Bxe_B2503)

MetaCyc: 63% identical to FADH2:quinone oxidoreductase (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN-20072

Predicted SEED Role

"TcuB: works with TcuA to oxidize tricarballylate to cis-aconitate" in subsystem Tricarballylate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>ABCV34_RS09550 tricarballylate utilization 4Fe-4S protein TcuB (Castellaniella sp019104865 MT123)
MQTLQDLTRDAVSTLLLSPGEQEVDRVMTICNACRYCEGFCAVFPAMARLLEFNKADIHY
LANVCHNCGACLHSCQYAAPHEFAVNVPQAMAAVRPQTYGEFAWPKALGQLYQRAGLTMA
LATAGGLAMFLVLVLIVNQGSWLHAPLAGNFYAIFPHNLLAAMFGLVFLYVIVALGIGVR
SFWRMLSPPAVSHVVMGAASLDATGNVLTLKYLDGGHGKGCNDDDDRFTQRRRVFHHFTF
YGFVCCFIATSLGTIYHYFLNDPAPYPFFSLPVLFGTVGGIGLLIGPAGLLWLNLVRHPD
HAVVGQQPMDRGFIALLILVSATGLVLLACRDTGVMGLLLAIHLGAVMGFFLTMPYGKFA
HGVFRSAALLKSALDRRMDGLTVARNA