Protein Info for ABCV34_RS09470 in Castellaniella sp019104865 MT123

Annotation: D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01662: HAD hydrolase, family IIIA
  • amino acids 2 to 144 (143 residues), 105.5 bits, E=2.5e-34
• TIGR01656: histidinol-phosphate phosphatase domain
  • amino acids 3 to 145 (143 residues), 148.5 bits, E=1.3e-47
• PF08645: PNK3P
  • amino acids 7 to 116 (110 residues), 24.7 bits, E=3.6e-09
• PF00702: Hydrolase
  • amino acids 12 to 138 (127 residues), 32.9 bits, E=1.8e-11
• PF13242: Hydrolase_like
  • amino acids 99 to 172 (74 residues), 44.8 bits, E=1.9e-15

Best Hits

Swiss-Prot: 69% identical to GMHBB_BORBR: D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase (BB4091) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: K03273, D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC: 3.1.3.-] (inferred from 72% identity to bpt:Bpet0777)

Predicted SEED Role

"Histidinol-phosphatase (EC 3.1.3.15)" in subsystem Histidine Biosynthesis (EC 3.1.3.15)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Biosynthesis of alkaloids derived from histidine and purine
• Ether lipid metabolism
• Fructose and mannose metabolism
• Histidine metabolism
• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Riboflavin metabolism
• Sphingolipid metabolism
• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-

Use Curated BLAST to search for 3.1.3.- or 3.1.3.15

Protein Sequence (184 amino acids)

>ABCV34_RS09470 D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase (Castellaniella sp019104865 MT123)
MKLIILDRDGVINQDSDAFVKSPDEWIPIPGSLEAIGRLSHAGWRVVVASNQSGIARGLF
SMETLGAIHTRMRQAVAEAGGRIDAIFFCPHGPDEACTCRKPLPGMLYDIAHRMDVHLDG
VPLVGDSLRDLQAAAAAGCTPWLVLTGKGNKTWETSGTSGELPAGTEVRNDLAAVADALL
KANS