Protein Info for ABCV34_RS09240 in Castellaniella sp019104865 MT123

Annotation: ribose-phosphate pyrophosphokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 PF13793: Pribosyltran_N" amino acids 7 to 123 (117 residues), 168 bits, see alignment E=1e-53 TIGR01251: ribose-phosphate diphosphokinase" amino acids 7 to 314 (308 residues), 398.2 bits, see alignment E=9.7e-124 PF00156: Pribosyltran" amino acids 162 to 268 (107 residues), 70.3 bits, see alignment E=1.8e-23 PF14572: Pribosyl_synth" amino acids 205 to 314 (110 residues), 105.4 bits, see alignment E=5.3e-34

Best Hits

Swiss-Prot: 90% identical to KPRS_BORPE: Ribose-phosphate pyrophosphokinase (prs) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: K00948, ribose-phosphate pyrophosphokinase [EC: 2.7.6.1] (inferred from 90% identity to bpe:BP3125)

MetaCyc: 65% identical to ribose-phosphate diphosphokinase (Escherichia coli K-12 substr. MG1655)
Ribose-phosphate diphosphokinase. [EC: 2.7.6.1]

Predicted SEED Role

"Ribose-phosphate pyrophosphokinase (EC 2.7.6.1)" in subsystem De Novo Purine Biosynthesis or Pentose phosphate pathway (EC 2.7.6.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.6.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>ABCV34_RS09240 ribose-phosphate pyrophosphokinase (Castellaniella sp019104865 MT123)
MAQDRFMIFTGTANPRLAVDVVNHLDMSLGKMTVGRFSDGEVMVEINENVRGKDVFVLQP
TCAPTNDNLMEIMVMVDALRRASARNITAAIPYFGYARQDRRPRSARVSISAKVVANMLQ
SVGVDRVMMMDLHADQIQGFFDIPVDNIYAGPILLGDIWSRNFQNLVVVSPDIGGVVRAR
ALAKQLESDLAIIDKRRPRANVSEVMNIIGDVNGRTCLIMDDMVDTAGTLCKAAQALKDR
GAGSVYAYCTHPVLSGEAVRRIQESALDEVVVTDTIPLAEGARQCGKIRQLSCASLLGET
ILRIATAESVSSLFAD