Protein Info for ABCV34_RS09015 in Castellaniella sp019104865 MT123

Annotation: cytochrome c biogenesis protein CcsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 187 to 212 (26 residues), see Phobius details amino acids 225 to 243 (19 residues), see Phobius details amino acids 251 to 273 (23 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 67 to 276 (210 residues), 93.1 bits, see alignment E=1e-30

Best Hits

KEGG orthology group: None (inferred from 66% identity to put:PT7_2179)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>ABCV34_RS09015 cytochrome c biogenesis protein CcsA (Castellaniella sp019104865 MT123)
MSVSIVFHLLAALAYAVLGLALWRPIVRAKPVRTTGTIGRSCLLGAIALHGIGLVSAVIV
PTGLQLGWVLALSTAMWLGMIVFWIENFLLRLDSLLLVLLPAAALISLLTAIFPQGYLVP
HANSDWLRVHLLIAMVAYGLITVAALHAMLMTTLDRHLHRPIASEGEQGVIARAMSAMPP
LLTLEQLLFRLIGIGFAVLTLTIITGIIVSLRLGGNALPMDHKTIFTLLSWVIFGVLLAG
RYIQGWRGRIALRWTLVGFAFLLLSYTGSRFVLEVILQRGSLG