Protein Info for ABCV34_RS08725 in Castellaniella sp019104865 MT123

Annotation: NADH-quinone oxidoreductase subunit NuoF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01959: NADH oxidoreductase (quinone), F subunit
  • amino acids 45 to 445 (401 residues), 638.1 bits, E=2.2e-196
• PF01512: Complex1_51K
  • amino acids 79 to 249 (171 residues), 151.7 bits, E=2.4e-48
• PF10531: SLBB
  • amino acids 273 to 321 (49 residues), 34.7 bits, 1.9e-12
• PF10589: NADH_4Fe-4S
  • amino acids 363 to 444 (82 residues), 113 bits, E=7.2e-37

Best Hits

Swiss-Prot: 51% identical to NUOF2_RHIME: NADH-quinone oxidoreductase subunit F 2 (nuoF2) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00335, NADH dehydrogenase I subunit F [EC: 1.6.5.3] (inferred from 81% identity to put:PT7_1759)

MetaCyc: 49% identical to NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial (Homo sapiens)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain F (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• NADH to cytochrome bd oxidase electron transfer I (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (456 amino acids)

>ABCV34_RS08725 NADH-quinone oxidoreductase subunit NuoF (Castellaniella sp019104865 MT123)
MSALDVLQKYATDALNPDLGGDAARSMIFHGRHINPQILAGLNGNNWGIQDYMARGGYTA
LKKILTTGMKPDDVIAELKASSLRGRGGAGFPTGLKWSFMPRNLPGQKYIVCNSDEGEPG
TFKDRDILRYNPHSVIEGMIIGGFAMGASVGYNYIHGEIFQIYQRFEEALDEARQAGFLG
DDILGSGFSFQLHAHHGFGAYICGEETALLESIEGKKGQPRFKPPFPASFGLYGKPTTVN
NTETFAAVPFVFQVGAQAYLEMGVEKAGGTKIFSISGDVELPGNYEIPLGTPFATLLELA
GGVKGGRQLKAVIPGGSSAPVLPADIMMKTNMDYDSIAKAGSMLGSGAVIVMDETRCMVK
SLMRLSYFYMEESCGQCTPCREGTGWLYRMMQRMEHGQGTADDIETLDSVAHNMMGRTIC
ALADAAAMPVRSFIKHFRDEFVHHIDHKDCVVAKYL