Protein Info for ABCV34_RS08675 in Castellaniella sp019104865 MT123

Annotation: phosphoserine phosphatase SerB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 PF13284: DUF4072" amino acids 5 to 49 (45 residues), 43.6 bits, see alignment 7.8e-15 TIGR00338: phosphoserine phosphatase SerB" amino acids 68 to 275 (208 residues), 208 bits, see alignment E=1.4e-65 PF00702: Hydrolase" amino acids 73 to 247 (175 residues), 66.2 bits, see alignment E=1.3e-21 TIGR01488: HAD phosphoserine phosphatase-like hydrolase, family IB" amino acids 75 to 246 (172 residues), 103.7 bits, see alignment E=1.1e-33 PF12710: HAD" amino acids 77 to 244 (168 residues), 87.8 bits, see alignment E=3.2e-28 PF05116: S6PP" amino acids 208 to 252 (45 residues), 20.6 bits, see alignment 7.6e-08 PF08282: Hydrolase_3" amino acids 209 to 277 (69 residues), 39.3 bits, see alignment E=1.6e-13

Best Hits

KEGG orthology group: K01079, phosphoserine phosphatase [EC: 3.1.3.3] (inferred from 68% identity to put:PT7_1749)

Predicted SEED Role

"Phosphoserine phosphatase (EC 3.1.3.3)" in subsystem Glycine and Serine Utilization or Serine Biosynthesis (EC 3.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.3

Use Curated BLAST to search for 3.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>ABCV34_RS08675 phosphoserine phosphatase SerB (Castellaniella sp019104865 MT123)
MAHIILQAPRLMAADIERLAAIACADGVQELAPTAMRLLNVDSSARDEVMAMAQAAHVDA
AWLESVHRLSDCKVLAMDMDSTLINIECIDEIADAVGRKAEVAAITEASMRGEIKDFSES
LRRRVALLRGVPESALEQVFIQRLRLNPGAEKLIEAARAHGLKTLLVSGGFTFFSERLRR
GLALDEAHANTLEVADGVLTGRVLGDIVDGAAKARHLQALAQSLDASPEQIIVLGDGSND
LPMMAQAYYSVAYRAKPVVRAQARFALDVSPLDAVLNWFRRQH