Protein Info for ABCV34_RS08460 in Castellaniella sp019104865 MT123

Annotation: RnfABCDGE type electron transport complex subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 TIGR01944: electron transport complex, RnfABCDGE type, B subunit" amino acids 3 to 140 (138 residues), 207.5 bits, see alignment E=6.5e-66 PF04060: FeS" amino acids 12 to 44 (33 residues), 49.2 bits, see alignment 1.2e-16 PF14697: Fer4_21" amino acids 77 to 131 (55 residues), 68.1 bits, see alignment E=2.1e-22 PF12797: Fer4_2" amino acids 78 to 96 (19 residues), 25.5 bits, see alignment (E = 3.1e-09) PF00037: Fer4" amino acids 79 to 99 (21 residues), 33.8 bits, see alignment (E = 7.5e-12) amino acids 108 to 130 (23 residues), 22.5 bits, see alignment (E = 2.6e-08) PF13237: Fer4_10" amino acids 79 to 125 (47 residues), 32.6 bits, see alignment 2.2e-11 PF13187: Fer4_9" amino acids 83 to 129 (47 residues), 27.3 bits, see alignment 1e-09

Best Hits

KEGG orthology group: K03616, electron transport complex protein RnfB (inferred from 66% identity to put:PT7_1721)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>ABCV34_RS08460 RnfABCDGE type electron transport complex subunit B (Castellaniella sp019104865 MT123)
MSSLIDALDALLPQTQCTQCGYDGCRPYAQAMAQGLADTNRCPPGGPRTIEALSHLLDRP
AHPLDPDCGTHQPFRVALIDEEHCIGCTLCIQACPVDAILGANQSMHTVIADDCTGCERC
VTPCPVDCITMVPAGRDWTPEDAGAARQRYQARNTRLLGRHAESAGPAARTLANKPALAT
PSDDHDKQDRIAQALARARARRS