Protein Info for ABCV34_RS08325 in Castellaniella sp019104865 MT123

Annotation: ribonuclease III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 TIGR02191: ribonuclease III" amino acids 8 to 220 (213 residues), 226.7 bits, see alignment E=1.3e-71 PF14622: Ribonucleas_3_3" amino acids 17 to 137 (121 residues), 133.6 bits, see alignment E=7.2e-43 PF00636: Ribonuclease_3" amino acids 36 to 126 (91 residues), 86.9 bits, see alignment E=2.2e-28 PF00035: dsrm" amino acids 154 to 219 (66 residues), 36.6 bits, see alignment E=8.5e-13

Best Hits

Swiss-Prot: 65% identical to RNC_BORA1: Ribonuclease 3 (rnc) from Bordetella avium (strain 197N)

KEGG orthology group: K03685, ribonuclease III [EC: 3.1.26.3] (inferred from 68% identity to put:PT7_1683)

MetaCyc: 50% identical to RNase III (Escherichia coli K-12 substr. MG1655)
Ribonuclease III. [EC: 3.1.26.3]

Predicted SEED Role

"Ribonuclease III (EC 3.1.26.3)" in subsystem RNA processing and degradation, bacterial or Two cell division clusters relating to chromosome partitioning (EC 3.1.26.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>ABCV34_RS08325 ribonuclease III (Castellaniella sp019104865 MT123)
MAGLDTLQAALDYHYQDQHLLEQALTHRSHGMPHNERLEFLGDSVLNFVVSTLLFTEHAE
MDEGDLSRVRANLVKQAALADIAQKLSLSTYLRLGEGELKSGGFRRPSILADALEAIFGA
LYLDGGYPQVSRVIERLYRPILSQIDVRTFGKDPKTLLQEIMQGRGLGLPRYEVVSTHGA
AHDQTFDVLCEAAQLDIRIQASGSSRRAAEQAAARQVIAAIEALGPARRSSRRHHKPAQL
SLPVAVPQEKK