Protein Info for ABCV34_RS08250 in Castellaniella sp019104865 MT123

Annotation: S-ribosylhomocysteine lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02664: LuxS
  • amino acids 16 to 155 (140 residues), 98.1 bits, E=2.1e-32

Best Hits

Swiss-Prot: 40% identical to LUXS_HALH3: S-ribosylhomocysteine lyase (luxS) from Halobacillus halophilus (strain ATCC 35676 / DSM 2266 / JCM 20832 / NBRC 102448/ NCIMB 2269)

KEGG orthology group: K07173, S-ribosylhomocysteine lyase [EC: 4.4.1.21] (inferred from 63% identity to gpb:HDN1F_13860)

Predicted SEED Role

"S-ribosylhomocysteine lyase (EC 4.4.1.21) / Autoinducer-2 production protein LuxS" in subsystem Autoinducer 2 (AI-2) transport and processing (lsrACDBFGE operon) or Methionine Biosynthesis or Methionine Degradation (EC 4.4.1.21)

MetaCyc Pathways

• S-adenosyl-L-methionine salvage I (3/4 steps found)
• autoinducer AI-2 biosynthesis II (Vibrio) (4/6 steps found)
• autoinducer AI-2 biosynthesis I (3/5 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (3/7 steps found)

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.21

Protein Sequence (160 amino acids)

>ABCV34_RS08250 S-ribosylhomocysteine lyase (Castellaniella sp019104865 MT123)
MIDVTALGWDPDTVGELDHRLLKAPSVKLRGAHAGTAGDVVYCIDLRLRLPNADAYLSDT
EAHSIEHFLLEGFQRRLPEHFIGVGVMGCQTGFYLTLLNEGRRRVIEDVLWRVFDDMLTA
TAVPYARIDQCGRWRNHDLALAQSVAREVLDCRAQWGEIA