Protein Info for ABCV34_RS08055 in Castellaniella sp019104865 MT123

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 62 to 91 (30 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 137 to 154 (18 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 21 to 115 (95 residues), 61.5 bits, see alignment E=4.4e-21 PF00528: BPD_transp_1" amino acids 41 to 221 (181 residues), 57.1 bits, see alignment E=1e-19

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 50% identity to azc:AZC_2486)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>ABCV34_RS08055 amino acid ABC transporter permease (Castellaniella sp019104865 MT123)
MNLDALHAAFFNLDIARQAVTPVLQGMAVTVQLGVLITLTGLVVGLVLAFVRAMRVPAVN
FFIIAFADVMRAMPPLVLLMVLFFAFPYIGISMTAFFATWLALSLVLSAFAEEIFWAGIQ
SIPKGQGEAARSTGMSWFQSMVWVIVPQACKLAVPPLTNRVIAITKSTALGAIVGLSEVL
NNSQTASSTLGNATPLTLGALGCLVIFVPIVLASRMLERRFQWKN