Protein Info for ABCV34_RS07885 in Castellaniella sp019104865 MT123

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 75 to 100 (26 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details amino acids 187 to 209 (23 residues), see Phobius details amino acids 247 to 272 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 96 to 272 (177 residues), 43.2 bits, see alignment E=1.9e-15

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 56% identity to nha:Nham_1209)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (281 amino acids)

>ABCV34_RS07885 carbohydrate ABC transporter permease (Castellaniella sp019104865 MT123)
MKTATPSPARTTGLYVATLLFVVFAALPFYVMLITSFKTQGDIFTPANNPFWFTESPTLD
NVKLLFLHTEFVRWLLNTVWVGLAVVAITLVLSIPAAYGLARIAGGWGETLGIGIFLSYL
VPPTLLFIPFSKVIAYLGLQNSLWALIVAYPTFTIPFCTWLLMGFFKGIPRDIEEQAMID
GHTRFSAFIHVILPLAVPGLMTVIVFAFTLSTSEFIYALAFVTHTADKTISIAVPTELIR
GDVYHWGPLLAGALIASIPIAVLYTFFIDQLVAGLTSVARR