Protein Info for ABCV34_RS07230 in Castellaniella sp019104865 MT123

Annotation: DNA translocase FtsK 4TM domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 785 transmembrane" amino acids 35 to 53 (19 residues), see Phobius details amino acids 82 to 106 (25 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 154 to 171 (18 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details PF13491: FtsK_4TM" amino acids 29 to 208 (180 residues), 134.6 bits, see alignment E=5.6e-43 PF17854: FtsK_alpha" amino acids 291 to 391 (101 residues), 104.1 bits, see alignment E=8e-34 PF01580: FtsK_SpoIIIE" amino acids 399 to 608 (210 residues), 255.4 bits, see alignment E=8.4e-80 PF09397: FtsK_gamma" amino acids 716 to 776 (61 residues), 88.9 bits, see alignment 2.8e-29

Best Hits

KEGG orthology group: K03466, DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family (inferred from 77% identity to put:PT7_1918)

Predicted SEED Role

"Cell division protein FtsK" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton or Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (785 amino acids)

>ABCV34_RS07230 DNA translocase FtsK 4TM domain-containing protein (Castellaniella sp019104865 MT123)
MARIPVTSSRSTRNVRNGPSPLQTRLTGLLREARWILLAALAGWLILVLATWHKSDPGWS
HSLYSGTTRNWGGTFGAYVADLMLYLFGASAWLWVLWLLRYVAVGFYRLTRIVLPSKVPE
LLPRVRWEVGIGFTLLFLGCMGTEALRLQDWGAALPAGAGGQLGHLLAKILAELAGNAGG
TLLLLAFIVMGSSLFFGFSWLNVSERVGLYLELGLRRLMDLKNAWQDRRVGATAQAERQE
MVETRQTQLVHEQPVRIEPTVTTVPKSPRVQQEKQQALFTVKEDPSLAGSLPALSLLDPV
EPSQETVSPETIEFTSRLIEKKLSDFGVSVIVVSAQSGPVITRYEIEPATGVKGSQIVNL
AKDLARALSLVRIRVVETIPGKNLMGLELPNPRRQIVRLSEILGSQVYHSSASLLTMALG
KDIAGNPVVVDLAKMPHLLVAGTTGSGKSVGINAMILSLLYKADASQVRLILIDPKMLEM
SVYEGIPHLLAPVVTDMRHAANALNWCVAEMERRYKLMSKLGVRNLSGYNAKIREAQKQE
QPIPNPFSLTPDAPEPLGTLPMIVVVIDELADLMMVVGKKVEELIARLAQKARAAGVHLI
LATQRPSVDVITGLIKANIPTRIAFQVSSKIDSRTILDQMGAEALLGQGDMLYQPPGTSV
PTRVHGAFVHDDEVHRVVETLKESGEPDYVEGLLEGAAEGETGDGVSSVTGFVDQENDPL
YDQAVEVVMRSRRASISFVQRNLRIGYNRSARILEQMERSGLVSPQQPNGNRDILVPAQA
GGEDE