Protein Info for ABCV34_RS06990 in Castellaniella sp019104865 MT123
Annotation: holo-ACP synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 62% identical to ACPS_BORBR: Holo-[acyl-carrier-protein] synthase (acpS) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
KEGG orthology group: K00997, holo-[acyl-carrier protein] synthase [EC: 2.7.8.7] (inferred from 67% identity to put:PT7_1454)Predicted SEED Role
"Holo-[acyl-carrier protein] synthase (EC 2.7.8.7)" in subsystem Fatty Acid Biosynthesis FASII (EC 2.7.8.7)
MetaCyc Pathways
- acyl carrier protein activation (1/1 steps found)
- acyl carrier protein metabolism (1/2 steps found)
- superpathway of chorismate metabolism (38/59 steps found)
- enterobactin biosynthesis (3/11 steps found)
- petrobactin biosynthesis (1/10 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.8.7
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (139 amino acids)
>ABCV34_RS06990 holo-ACP synthase (Castellaniella sp019104865 MT123) MGSGSIAGIGTDLLRVDRIERIHARHGGRFVRRILGTDEQLVHARRQARDPRRGILYLAT RFAAKEAFSKAIGLGIHMPMTWSRVQIINRRGGAPEIHLSGPLKDWYDARFGPAHVSMTD ESDVVAAFVVVENLPRDQA