Protein Info for ABCV34_RS06990 in Castellaniella sp019104865 MT123

Annotation: holo-ACP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 TIGR00516: holo-[acyl-carrier-protein] synthase" amino acids 6 to 133 (128 residues), 84.1 bits, see alignment E=9.6e-28 TIGR00556: phosphopantetheine--protein transferase domain" amino acids 6 to 133 (128 residues), 67.5 bits, see alignment E=1.2e-22 PF01648: ACPS" amino acids 8 to 107 (100 residues), 52.8 bits, see alignment E=1.9e-18

Best Hits

Swiss-Prot: 62% identical to ACPS_BORBR: Holo-[acyl-carrier-protein] synthase (acpS) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: K00997, holo-[acyl-carrier protein] synthase [EC: 2.7.8.7] (inferred from 67% identity to put:PT7_1454)

Predicted SEED Role

"Holo-[acyl-carrier protein] synthase (EC 2.7.8.7)" in subsystem Fatty Acid Biosynthesis FASII (EC 2.7.8.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (139 amino acids)

>ABCV34_RS06990 holo-ACP synthase (Castellaniella sp019104865 MT123)
MGSGSIAGIGTDLLRVDRIERIHARHGGRFVRRILGTDEQLVHARRQARDPRRGILYLAT
RFAAKEAFSKAIGLGIHMPMTWSRVQIINRRGGAPEIHLSGPLKDWYDARFGPAHVSMTD
ESDVVAAFVVVENLPRDQA